guest

Tips Pikat Hati Bakal Mak Mentua

Wink (^_^)..Wink (^_^)..Wink (^_^)..

Ohooo... suka kalau bab2 pikat hati ni..ahakss*bebola mata mama tengah berpusing2 ketika ni,mbahaha.

hokey tanpa membuang masa lagi kita terus kepada point pertama..ambik ketas,ambik ketas..pen sekali ye


OK ini tipsnya:

Yang pertama

BERSALAM DAN CIUM TANGAN BAKAL MAK MENTUA

bab2 kiss ni sentitip sikit ni,kalau nak cium beralakadar la ye.jangan cium sampai dua tiga kali pulak,dah la dua tiga kali berbunyi pulak tu,bukan suka,geli gelaban kang macik tu.kenapa harus diKISS pulak mama?perlu sangat ke?tangan macik tu bukan wangi pun..
sebabnya,hati keibuan ni cepat tersentuh tau,kalau kita cium mesti dalam pala hotak macik tu"eee..hormat orang tua budak ni,ok juga ni buat menantu"hah!tu dah dapat point pertama da..ye dak..free2 je..ngahahaha.

eh!..tapi.. tapi kan,yang boy cium tangan pakcik tu je ye,yang girl sama girl..jangan ngegada nak salam semua.kenanya mereka tu halim holamak...hulur tangan da 10minit tapi tak bersambut.bertepuk sobolah tangan la ko nakk..hihih..
muka da merah,pink,kelabu,hijau biru daaaa..

kedua:TUNDUKKAN KEPALA BONGKOKKAN BADAN.

Haih,apa ni mama?tunduk2..bogok'2..eh! bongkok2..tak main la skil lama ni..
HOkey2..camni ,kalau kita buat gitu,automatik bakal mentua tu nampak kita ni bersopan santun,kalau dah anak begitu,maknanya automatik mereka akan fikir mak bapa kita didik kita dengan baik,so kesan positifnya, mereka akan fikir kita ni dari keturunan yang baik2..tak gitu?betul kan?kan?
tapi,jangan pulak nanti kebetulan terserempak dgn keluarga bakal mentua waktu  melintas jalan raya,waktu tu mereka dalam kereta,ko nak melintas jalan raya tu tunduk2 bongkok2 juga..haih..tu tahap kritikal da tu.jangan buat ok?
ngahaha..*cuba bayang sikit*

ketiga:RINGAN-RINGAN KAN TULANG.

Aaaa..ni bab mama suka ni kalau nak cari menantu nanti,insyaallah..ahakss..
ringan tulang?nak kena terapung-apung,loncat2 menandakan ringan tulang ke mama?camtu ke?
haih..bukan camtu la,ringan tulang tu maksudnya rajin.rajin maksudnya kalau bertandang ke rumah bakal mentua tu,kalau macik tu sibuk nak siapkan air ke,kuih ke,tak kira la sapa,yg penting dari keluarga mereka,tolong2 la skit.jangan pulak nanti ko suru bibik tu berehat,sebab ko  nak buat semua keja,padahal keluarga2 si bakal2 semua di depan,ko pulak bizi sangat ketong2 ketang di dapur..hahaha.

eeee,,jangan2,tu dah melebih da tu..agak2 la nak merajin kan diri pun.hehe.boleh la tolong2 angkat2 air ke,tolong la apa macik tu buat.yang ringan2 je,jangan berhempas pulas dah. 

keempat:CONTROL AYU CONTROL MACHO.

Wakk..kaii..perlu ke semua tu mama?tak hipokrit ke?baik jadi diri sendiri..
hoi..hoi..mai sini jap !mama nak tarik telinga skit!"jadi diri sendiri..jadi diri sendiri konon,engko nak tunjuk perangai ko lasak tu ke?yang suka loncat2 tu..eeee..jangan2..nanti kena rijekk ko nak..

kalau kita control kan,nanti menyerlahlah kesopanan kita tu,cakap pulak lemah lembut(bagi si girl)sopan(bagi si boy)nanti hati si bakal2 tu pun sedap je pandang kita kan?rasa kompiuden je nak bermenantukan kita.tak lah berkerut2 keningnya.. mbahahahak..padahal..


kelima:TUNJUK ALIM SKIT..

Aiii mama ni nak suru kita hipokrit lagi la ni..
bukan cam tu,betulkan nawaitu tu ye.bukan berniat nak riak,tapi kalau dah masuk waktu solat tu camna gink??nak termenung2 juga ke disitu taknak solat??at lease kata la macik tu,"macikk..saya nak balik dulu la ye,waktu asar da masuk da ni" ahakss..kalau macik tu bagi pinjam bilik suru awak solat dirumah mereka je..aaaa..tu dah lampu kuning da tu..hehehe.tandanya macik tu da beri kepercayaan tu..tepuk tangan skit .yeeeaaaa..



Huh??sedar tak sedar dah lima tips mama bagi kan?patut la mama rasa kebas2 da pinggang mama ni..banyak lagi tips sebenarnya,itu baru asas tu,tapi,da penat la..nanti mama sambung lain entri hokey?



Renungan:ingat,setiap orang tua mahukan yang terbaik untuk anaknya.lebih2 lagi berkaitan masa depan.Jika anda mahu melakukan sesuatu anda akan mencari jalan dan jika anda tidak mahu melakukan sesuatu anda akan mencari alasan.




-Sekian Terima Kasih-

Happy Birthday Boyfriend mama..

Aik?tajuk cam panas je..
mama ada boyfriend?hoi mama cakap bebaik skit*nak publisiti ka hapa?*sebenarnya lama da mama sembunyikan rahsia ni,tapi hari ini bersamaan 29 dec 2011 mama dengan rela hati membuat pengakuan sejujurnya di sini..

maafkan mama papa,
lepas ni mama sanggup tanggung apa jua tindakan papa,tapi mama haraf sesangat papa dapat terima kenyataan dan pengakuan berani mati mama ni..

huhu..sob2..isk..isk..split!*hah ambik ko tempek skit hingus kat lantai nu*
mama macam tak berani nak berterus terang,biarlah gambar2 ini yang menerangkan semuanya..*tengok betul2 papa,jangan berkelip tau cinta*
kalau gambar tidak terang dan kecil halakan mouse kepada gambar..nanti pandai besar siiiikit tu gambar..mbahahaha..







memandangkan mama tidak sanggup untuk berkata-kata mama wakilkan minah ni,"Minah apa lagi cakap la..slow talk tau supaya papa dan si comel2 tu faham2 belaka..silakan minah:








Ohohoho..sudah jelas semuanyakan?usah berselindung di sebalik mee lagi..so..HAPPY BIRTHDAY Cinta hatiku..auch so sweet*mbahahahaha mama mengedik ka itu*
mama:oits!! sory skit ea..orang belakang mama ni yang cakap..
la~la~la~

mama:
mama doakan semoga allah panjangkan umur papa dan murahkan rezeki,jadi papa yang soleh,bertanggungjawab dan penyayang,diberikan kesihatan dan keselamatan yang terbaik.dipermudahkan setiap urusan dan ceria2 selalu dan berbahagia dunia akhirat.amin ya rabbal alamin~


*podah!!gambar tu poyo sgt..senyum2 konon*hahaha..
ok la tu yang penting ada kaitan siiiikit..kan?kan?












Alesya:
min ya rabbal alamin~alesya pun wish sama cam mama juga tau papa,tapi..tapikan papa,mana hadiah untuk alesya?bukan kayau birthday kena ada hadiah2 ke papa?
papa beyum beli ka?hokey..alesya tunggu tau papa..muah..muah..sayang papa selalu..



*aissssyyy...nak doa kena rapatkan tangan tu sayang..*bukan luas2 cengitu..ah boleh la tu,yg ptg ada siiikit-siiikit kaitan*mbahaha..



-Sekian Terima Kasih-

Tips Mengelak Diurat Buaya Terbang

Hi comel,
Comel,comel,comel,hah! puas da cakap comel.tapi sapa yang comel ni awak ka saya?
saya ka awak?hahaha..awakla yang comel..shhhhtt!!..pheeewwiiitt!

haih,sudah rimas dengan kerlipan mata buaya2 terbang diluar sana yang pantang jumpa comel2 seperti kita kita ni.cuba teka siapa kita2 tu,oh no..no..saya tidak termasuk dalam kita2 tu,saya kurang comel,tapi banyak manissssss*mbahahaha sila masukan jari telunjuk kanan anda kedalam mulut kemudian goyang2kan anak tekak anda dan silakan muntah*mbahaha

mama,pleaseeeee!jangan nak ngengada lelebih boleh?..silakan fokus kepada tajuk.
hokey2..kita kembali kepada tajuk


TIPS MENGELAK DIURAT BUAYA TERBANG.

eh, awak tahu ke apa maksud buaya terbang tu?lets me xplain ye*sessshh!cakap omputih pun tak betul,ada hati*mbahahaha..bio la..bio la..sekali lagi bio la..em,em,emm,,not biola hokey tapi biar la..*jari telunjuk di tegakkan dan dicondongkan kekiri dan kekanan konon*

Ok,stop!stop!stop!.kata nak xplain tadi bila nak mengXplainnya.bulp! mama tutup mulut hokey biar jari mama je yang menari2 sekarang..ek'a..ek'a..tarakuca..ca..bila larut malam..
STOP PLEASEEE!!eeeeeee..susah lah dia ni pandai syok sendiri!!
ops sorry comel,terlabih suda bilang stacy..saya ni memang begini ni kalau suda enjin panas susah mahu berhenti merefek kerefek ni favourite saya juga.i'm sorry...(^-^)V
Peace...

Buaya terbang tu jejaka2 yang pantang nampak perempuan berdahi licin lalu depan mata,hah!mula la tu nak kelip2 sebelah mata,mengeluarkan bunyi2 seperti ini:
shuuuttt..shuuutttt!
pheeewiiiittttttttt!
jalan sengsorang ke?

OK,TIPSNYA:

BERCAKAP SENDIRIAN

ya.awak kena bercakap sendiri2 bila bersendirian,kalau boleh hitung2 sekali jari jemari tangan kiut awak tu,kalau boleh jari2 kaki sekali..dengan taktik ini,si pengurat takut nak tegur,kerana disangkanya kurang siuman.mama kata"biar kurang senyuman jangan kurang siuman"mbahaha..

BESARKAN BUKAAN MULUT DAN BESARKAN SUAPAN
Ya.teknik ini saya selalu praktis masa bujang2an dulu.memang berkesan.ngeee.
Bila berada di meja makan,jangan control2 ayu beauty segala.kerana lagi banyak awak mengontrol lagi banyak awak menarik perhatian si pengorat.so caranya,kalau dia pandang awak,buat2 la tidak nampak,lepas tu buka mulut luas2 pas tu besarkan suapan.dengan taktik ini,automatik niat pengorat terbatal.sebab takut memerlukan belanja makan yang banyak bila couple dengan awak..mbahahaha..

PURA-PURA BERCAKAP DENGAN BOYFRIEND DI HANDPHONE

Ya.taktik ini memang berkesan.bercakaplah manja2 di telefon kalau nak gedik2 sekali,kuatkan sedikit suara.agak2 didengar oleh si pengorat je la,kang tak pasal2 makcik pakcik anak beranak semua toleh dengan awak pulak.no,no,no,no..*gerakkan jari ye*cakap sayang2 ke,daling2 ke,cintaku ke,whatever la,walaupun ketika itu handphone awak takde kreadit,sudahlah kreadit takde,bateri pun kong..teruskan lakonan awak tu jangan segan2.mbahahaha

BUAT AKSI TERLEBIH SEDIKIT

Aaaa..jangan tarlabih sudah pulak, sikit2 boleh la.contoh cam kerutkan dahi 50% ke*camna tu?entah mama pun tak tahu.mbahahaha*muncung2kan bibir 10 inci kedepan ke,*camna tu?entah mama pun tak tahu.mbahahaha*garu2 kepala ke,picit hidung ke,jangan korek hidung sudah.dengan taktik ini,si pengorat tak jadi mengorat kerana menyangka awak mempunyai penyakit pelik.mbahahaha..

hayooo..mama suda penat la,penat menaip,penat duduk,almaklum sudah tua begini la lumrahnya,kecomelan pun kurang suda,ahakss!!
jadi anak2 comel di luar sana tu,kalau nak tips ni,bolehlah praktis2kan ye..lelaki pun kalau nak boleh juga try tips ni.tapi ada ke lelaki yang takmo diurat perempuan a?*jap mama fikir jap ye*
baca entri lain dulu la..mama tengah berfikir ni..
emm..em..em..*mata pandang atas,jari telunjuk di bawah dagu bajet comel*jom buat sama2..ahakssss..

haik??ni katun boboi boi kan?napa muka si comel tu muka anak mama pulak?*sudah2 la ko mama,ingat org tidak tahu,pasal edit menghedit gambar ?*





-Sekian Terima Kasih-

Waktu Ini Sesuai Minum Air

Blup.blup..blup..
slupppppp..gluk..gluk..gluk..
Nampak tak saya dimana?
ueyuhuuuuuu..*sambil lambai2 tangan*

sini..!sini..!dalam tangki ni
tengah menyelam sambil minum air disamping mencari ikan dan berudu.
belum nampak lagi ke?
haih..
ok kejap!kejap! saya naik dulu..
Aaaaaa..puitttt..*tengah sembur air mcm dolphine konon*

Emmm.. saya baru pas minum air ni..alhamdulillah.
tengok perut goyang2 kan?
pusing kiri gulk..gulk..
pusing kanan..gulk..gulk..
kembung suda..

Kamu suda minum?
Minum air apa?
milo?kofe?nescafe?kekola?

Ooo..please say'NO' to minuman2 tersebut
and say "YES" kepada air kosong atau air masak atau air menelar atau air mata air,atau etc..jangan air berperisa suda.*wak.kaiiii..yes,no yes,no..cakap omputih tu*

hadoiii..banyak betul merefek kerefek pulak..
mama,silakan kembali kepada tajuk asal hokey?..
hokey!hokey! kita berbalik kepada tajuk.

WAKTU INI SESUAI MINUM AIR..

Bila tu mama?,..
hokey waktu ini yee anak2..

Selepas bangun tidur.
Minum dua gelas air masak untuk membantu mengaktifkan organ dalaman.

30 minit sebelum makan.
Ianya membantu penghadaman dan membuatkan perut lebih bersedia memberi ruang untuk kemasukan makanan

Sebelum mandi.
Minum segelas air masak kerana ia membantu pengaliran darah dan mengurangkan tekanan darah.

Sebelum tidur .
Minum segelas air masak untuk mengelakkan terkena strok dan serangan jantung ketika tidur.

Nah! suda tahu kan?bila waktu2 terbaik kita harus minum air..harus ya harus!
untuk kebaikan badan sendiri juga kan?
so..rerajinkan diri minum air hokey..
jangan minum sambil tidur pulak..
kalau terjadi juga saya
tidak ikut-ikut a.k.a bertanggungjawab..

itu! itu! saya nampak anak ikan dan berudu sedang berkelahi..
saya pergi leraikan dulu persengketaan mereka tu..
teruskan minum air..terus kan..terussssss kaaaaaannnnn!
Assalammualaikum..

yaaaakkkkk DEBUSSSSSSS!!*sudah terjun semula*

hahahaha..*ops sori saya tergelak pulak*




-Sekian Terima Kasih-

Hatiku Berkecamuk Nak Mengamuk

(26412refgdrs6avdcgdfyuajvbnasgfcjafvghsfteagcdbasdhjkfydgcfytefmvewbvfbadfgfsedtwrdjqwdfahjdryjawefdtrewafvgdcdsaydrewyfdsrfaksduyewytrhevcbvdgarweyGDHJAGFDYUEWTRYUEWRTFEW8)
*Ayat ni korang jangan pening2 nak baca hokey?biar aku je yang pening*

Haishhh!!hati tengah berkecamuk ni!!
geram betul diriku!
kes ni rasanya suda dua tiga kali berlaku.
tapi aku pendam2 je selama ini.tapi kali ini kesabaran aku suda memuncak!
betul2 geram betul!
haitss!!mencik!mencik!mencik metul lah!!

Ceritanya begini..

Aku ni siok2 taip entri,
siap sudah semua..
ayat pun baik punye..
berpuas hati suda ni,
tingal nak publish je lagi..
tapi aku mahu simpan gambar
konon mahu mengkontroversikan lagi entri aku tu.

Tapi,bila gambar suda di upload,
buka pratonton,gambar tak menjadik!yang keluar kod gambar tu je..
OPKOS!!kena padam la kod tu kn?
Takkan nak publish cengitu..

tapi bila aku padam,
separuh entri aku terDELETE.
haiyo..yo.!aku bengang la kan?
macammana nak cari balik entri aku tu aku pun tarak tahu..
so aku tekan la BACK ,konon2 nak tunjuk pro la tu,
bila tekan back
terus minta catatan baru
entri yang separuh tadi terus lesap

HAIH!
(26412refgdrs6avdcgdfyuajvbnasgfcjafvghsfteagcdbasdhjkfydgcfytefmvewbvfbadfgfsedtwrdjqwdfahjdryjawefdtrewafvgdcdsaydrewyfdsrfaksduyewytrhevcbvdgarweyGDHJAGFDYUEWTRYUEWRTFEW8)

WAAAAAAAA..TOLONGGGGGGGGGGGG!!!!
kepada ticer2 yang pro menangani masalah ini sila komen di entri ni ..
ajarin gue dong gimana caranya mahu cari balik entri yang hilang tu..tekan2 draft tapi tidak berhasil..

uwwwaaaaaaaa...huhuhuhuhu..isk..isk..sob..sob!!

*tidak mo letak gambar lagi,nanti ni pun ilang juga..takmo aku*huhu

*maafkan penganti diri AKU kepada yang lebih berusia*


-Sekian Terima Kasih-

Suka Main Bayang-bayang

Membelakangi lampu tidur terbentuk bayang-bayang,
sambil mengadap dinding
Pusing kiri pusing kanan,
angkat tangan keatas,angkat tangan kebawah,
Tepuk tangan,gerakkan jari,
senyum-senyum loncat-loncat..

Eeee..meremang je bulu roma tengkuk mama bila tengok si kecil mama ni buat begitu begini.*macam ayam jantan jumpa ayam jantan tu*haishh..

Di usia 10bulan ini,macam2 perangai baru dipelajari.Macam2 benda yang sicomel mama ni mahu cuba,apa yang mama paling suka..suka ..suka..menyuka ialah bila dia jumpa cahaya matahari ataupun cahaya lampu.mula lah tu..buat gaya cam diatas tu..seronok betul mama tengok...emm..emm..emm..rasa mau penyek2kan je bibir ni..di katup katup rapat...faham ke perkataan katup2 tu apa?hehe..*ketawa sopan ye,siap tutup mulut lg*

Katup2 tu sejenis makanan raja2 yang hampir pupus..ops suda!!nanti mama yang jujur ni menipu pulak*sila masukkan jari telunjuk dlm mulut goyang2 anak tekak dan silakan muntah*

katup2 tu sebenarnya perkataan yg direka mama sendiri,takde dalam kamus dewan pun,kalau ada pun kebetulan la tu..ahaks..

maksud katup2 tu,kita pertemukan bibir atas dan bibir bawah,kemudian hisap kedalam sedikit bibir kamu tu,jangan telan terus pulak. ok,stay disitu..kemudian tekan sekuat hati..emmmmmm...aaaa.. cuba try test buat..anak-anak...bagus! kamu meeemang pandaiiiiii...

Ok..kalau boleh amalkan selalu,ni pun salah satu senaman muka juga tau..
kalau nak awet muda baby face hah! jangan lupa buat bila ngadap cermin hokey?



bukan setakat bayang2 menjadi kegemaran,tengok cermin pun menjadi kesukaan...emmmm..emmmmm..eemmm..*kalau ada bunyi begini,apa yang perlu dibuat anak2..?*ahaaa..pandaiiii..buat senaman muu..muu..muuu...ka.
ya betul!!pandai kamu..

hahahaha*o im sorry mama terketawa besar la,rasa kurang sopan lak*

la~la~la~la~la..
*mama sambung cari semut dulu *


-Sekian Terima Kasih-

Kejadian Yang selalu dielakkan sudah pun terjadi

Malam semalam jam 10.pm mama dan puteri masuk tidur awal.Berlainan dengan malam2 sebelumnya kalau tidak jam 12 ataupun jam 1.am baru dapat melelapkan mata setelah puas melayan karenah si puteri sehingga kepenatan bermain.papa masih menonton tv diluar. so kami masuk tidur dulu

Seperti kebiasaannya puteri mama akan menyusu sebelum tidur,bila suda kenyang,bergantung kepada moodnya, sama ada terus bermain ataupun terus tertidur.
Tapi,malam itu mama tengok dia suda terpejam2 mata menandakan suda
mengantuk,pirasat mama,dia akan tidur,so mama pun terlena dulu dari dia.(ish macam mana boleh silap ni mama!)

Tiba-tiba Gedebukkkk!!!!!
Dalam keadaan mamai dan jantung berdebar mama,meraba2 dimana si baby
kecil,bila mama tengok di bawah,
Ya Allah,anak mama suda tersembam di lantai. suda jatuh katil.
Waktu tu dia belum nangis,sedang mengusap2 dahi,tapi bila mama angkat dan peluk,
dia terus teriak menangis(agaknya puteri mengadu kesakitan dengan mama kan?)
"Alalala.toyong..toyong anak mama yook.."

Papa masuk dengan kening berkerut,
waktu tu jiwa mama diselubungi rasa takut dan bersalah.takut dengan
papa(abis la,merasala tempelengan pertama dari papa kali ni)
rasa bersalah dengan anak(maafkan mama sayang..)

Tapi,nasib baik papa jenis yang sentiasa cool,(terima kasih cinta)
diambilnya alesya.cek sana sini,mencari manatau ada kecederaan,alhamdulillah..di badan tiada tetapi ada kesan lebam di dahi.(keciannya anak mama)


Bila tangis puteri suda reda,papa pulak yang ganti buat aksi,dengan muka yang serius try juga sembamkan muka ke lantai,kononnya mahu merasa kesakitan yang dialami anak(hehe..lawak juga waktu tu)

Ini kes ke-4 berlaku.3 kes sebelum ini semuanya selamat.si kusyen dan si bantal la yang dikerah malaikat untuk membantu menyambut anak mama bila terjatuh.ada sekali tu masuk dalam bakul pakaian,namun semalam hero2 ini tiada di sisi.Allah mahu menguji kekuatan fizikal anak mama tu.
so keputusan yang dibuat mama,
anak mama kuat dan bersemangat,sebab walaupun suda lebam namun kecergasan dan kelincahan masih sama bila berada diatas katil.tiada pun tanda mahu berhenti mencuba.hehe..
tahniah sayang..muah!!
tengok la ni,ini merupakan lakonan semula,nak test berani lagi ka berada dihujung katil atau tidak.

Nota mengadu:
Entri di taip untuk kali kedua,entri pertama tadi suda siap,dengan ayat yang tersusun rapi,tingal nak publish lagi,sekalinya tuppp!!
anak mama cabut plug.
mahu marah pun tiada guna..uwaaaaaa...lapar suda ni..







-Sekian Terima Kasih-

10 Tabiat Yang Menyebabkan Kerosakan Otak

inikah yang dinamakan kerosakan HOTAK??ohoho..cantiknya..
waaaa huhu..
Siapa sangka aktiviti seharian kita boleh menyumbang kepada kerosakan otak kita,saya pun tidak menyangka tabiat2 ini boleh menyebabkan kerosakan otak.Namun setelah mengetahui,sekarang saya cuba untuk mengelak 10 tabiat2 ini.

Cuba perhatikan 10 tabiat2 ini,mesti ada dua atau tiga yang selalu kita buat,paling kurang pun satu,atau mungkin kesemuanya sekali.hehehe..bahaya~bahaya~

1. Tidak mengambil sarapan pagi
Apabila seseorang tidak mengambil sarapan pagi, paras gula dalam darah akan menjadi rendah. Ini akan mengakibatkan kekurangan bekalan nutrisi pada otak dan menjadikannya kurang aktif.

2. Terlebih makan
Ia akan membebankan pembuluh darah otak dan mengurangkan kuasa mental otak.

3. Merokok
Asap rokok akan mengakibatkan sel-sel otak terjejas atau terbakar dan boleh mengakibatkan penyakit 'Alzheimer'

4. Penggunaan gula yang berlebihan
Pengambilan gula secara berlebihan akan mengganggu penyerapan protein dan nutrisi. Selain daripada itu, ia akan mengganggu perkembangan otak yang sihat.
(Huhuhu..kurang gula pun susah terlebih gula pun susah)

5. Pencemaran udara
Otak adalah pengguna oksigen terbesar dalam badan manusia. Pencemaran udara boleh menyebabkan pengurangan bekalan oksigen ke otak dan keaktifan otak.
(Waaaaa..mau pulang kampung..!!)

6. Terlebih tidur
Tidur adalah bagus untuk merehatkan otak tetapi masa tidur yang panjang boleh mengakibatkan sel-sel otak kita mati.
(Gulpp..dulu saya suka tabiat ni,tapi sekarang kurang suda,gila blogging suda.muehihi)

7. Menutup muka ketika tidur
Tidur sambil menutup muka akan mengakibatkan otak menerima lebih banyak karbon dioksida berbanding oksigen dan ini akan membawa kerosakan kepada otak.
(oho..ho..ho..tidak!nehi.nehi babuji...!! ni peveret ni..uwaaa)

8. Membiarkan otak bekerja semasa kita berada di dalam keadaan kurang sihat.
Bekerja semasa anda kurang sihat boleh mengurangkan keberkesanan otak dan juga membawa kerosakan kepada sel-sel otak.

9. Kurang berimiginasi
Berfikir adalah satu cara terbaik untuk melatih otak kita. Kurangnya berimiginasi boleh menyebabkan tahap kecerdasan/keaktifan otak menurun.

10. Jarang berfikir
Jarang berfikir akan menyebabkan otak kita kurang aktif. Oleh itu, perbincangan yang membina boleh menambah keberkesanan kecerdasan otak kita.


Gulp..!!gulp..!! macam tidak percaya kan?hi.hiiii..
Jadi kalau kamu mempunyai tabiat2 bertuah yang tersenarai diatas,pandai2 lah kamu cari gaduh dengan tabiat2 tersebut ya..
Saya sekarang ni tengah bermusuhan dengan mereka,walaupun sebenarnya tidak sanggup,namun untuk kebaikan tuan otak yang satu..saya rela bermusuhan dengan 10 ini.

Nota meroyan:
Alangkah best kalau otak kita boleh cabut dan boleh cuci pas tu polish,kalau sudah rosak beli pulak yang lagi canggih,lepas tu otak yang lama simpan elok2 buat koleksi..emmm..
la~la~la~la~
senyum sikit
razz




-Sekian Terima Kasih-

Langkah Pertama

Alhamdulillah,
Kini puteri mama sudah 10bulan 1minggu 4hari,
perkembangan terkini,sudah pandai berdiri,
sekejap masa lagi akan pandai pulak berlari,
Bersedialah mama,mengejar kesana kemari.

kini puteri dalam usaha mengangkat kaki sebelah,
Tapi baru selangkah sudah nak rebah,
kalau dah dapat dua langkah,
puteri menari,buat mama dan papa ketawa berdekah-dekah.
muehahaha..

Gembira hati tidak terkata,
melihat puteri membesar di depan mata,
Terima kasih ALLAH yang maha pencipta,
Kerana kurniakan kami seorang permata.

NOTA BUAT PUTERI:
Waktu ni alesya sudah semakin aktif tau sayang,suara makin nyaring bila teriak,makin cergas dan makin manja.kadang2 buat mama rasa mahu gigit2..grrrrr..


-Sekian Terima Kasih-

8 Ciri Lelaki Buruan Wanita


Hah???Wanita memburu lelaki??
Perigi cari timba ka apa?
bukan!bukan! bukan itu maksud saya bah!
baca dulu,nanti faham la tu(rajin2 baca sampai habis tau,kalau mau faham,)ngee..

Mungkin masih ada sesetengah lelaki belum tahu apa sebenarnya ciri2 lelaki yang selalu membuatkan girl2 diluar sana terpesona kan?"eemm...Nampak tidak hensem,hidung kembang pulak tu,tapi asal dia ramai sangat perempuan minat a?aku yang macho sikit dari tom cruise ni kenapa perempuan kurang minat??emmm kenapa a?"

Aaa..kaum lelaki mau tahu kenapa?
mungkin lelaki tersebut memiliki 8 ciri2 tersebut:


1.Yakin Pada Diri
Sebab apa,kerana Keyakinan diri adalah kualiti penting yang sering di cari oleh wanita, lakukan sesuatu perkara itu dengan terbaik. yang paling penting, jangan memperkecilkan kelemahan diri sendiri. Ada yang menyerah kalah sebelum berbuat apa-apa. Ini bukan sifat lelaki sejati. Sebaliknya kamu harus berikan alasan kukuh, kenapa kamu tidak boleh lakukan. penting untuk berlatih bersungguh tanpa mengenal erti putus asa dan sentiasa berfikiran positif.

2. Pandai Buat Lucu
So,tips untuk kamu,Jangan bercakap terlalu serius atau ketawa yang dibuat-buat. lebih teruk kalau tersengeh-sengeh tak tentu fasal. Ingat untuk menjadi seorang yang kelakar tidak semestinya kamu membuat lawak bodoh. Belajar Berlawak secara spontan dan bersahaja kerana ini akan menghiburkan hatinya. Lawak bersahaja itulah yang membuatkan si dia akan terus merindui karenahmu.tak caya?try tanya gegirl?Betul kan girl??

3. Romantik
Aa,rasa kamu macam mana?kalau kamu mahu tahu,wanita sebenarnya menginginkan seorang yang romantik. Ingat, romantik bukanya gatal atau miang, lelaki yang romantik adalah pandai mengambil hati dan bijak menggunakan kata-kata. Suka mengambil berat dan penyayang kata-kata. Suka mengambil berat dan penyayang juga menjadi salah satu aspek yang menarik perhatian wanita. Biar seseorang wanita itu kelihatan 'rugged' atau agresif. namun dalam hal teman lelaki, kebantakannya memilih yang romantik.So,lepas ni belajar2 la romatik ya boboi..ngeee.

4. Wang
Betulkah wanita suka lelaki yang berduit?kalau tak caya,try pakai baju atau kasut jenama, kamu bakal mencuri pandang wanita. biar papa asal bergaya. papa dalam hal ini adalah kamu perlu menyesuaikan diri dengan gaya orang kaya. Biar terpaksa mengeluarkan wang yang lebih sedikit, namun hasilnya hanya kamu yang mendapat nikmatnya. Umpama membeli kereta BMW walaupun tanpa aksesori, ia tetap di lihat gah berbanding dengan kereta biasa yang penuh dengan aksesori.Tapi janganlah pulak kamu selamanya begitu,kenalah berusaha sunguh2,supa betul2 berduit.okey?senyum skit..
wanita mahu kehidupan yang selesa dan terjamin untuk masa depan tau.

5. Bijak
Wanita sering mengimpikan mendapat seorang lelaki yang berpenddikan dan pandai. Jika kamu berasakan kamu kurang bijak, mungkin kamu boleh mengambil langkah untuk melanjutkan pelajaran. Luangkan masa kamu mendengar berita CNN dan rajin mengisi teka silang kata supaya tampak berilmu. Wanita suka lelaki yang bijak dan suka membaca. Tidak semesti kamu adalah seorang ahli akademik. caranya, baca ulasan buku seolah olah kamu telah membaca keseluruhan buku tersebut. pakilah cermin mata yang tidak berkuasa untuk memperlihatkan kamu bergaya seperti seorang intelek.hehe..
kena pandai berlakon sikit2,jangan melampau sudah.

6. Sensitif.
Setiap kali pasangan kamu bercakap, dengarlah dengan khusyuk sambil memandang bola mata hitamnya.jangan sampai juling pulak,ngeee..
malah mungkin kamu boleh berkata " saya memahami perasaan awak" bagaimanapun jangan pula kamu terlalu sensitif kerana sebagai tempat berlindung tentulah mereka memerlukan pohon yang kukuh.

7. Suka Kanak-Kanak
Wanita menganggap seorang lelaki yang bijak adalah berpengetahuan luas dalam semua bidang termasuk menjaga kenak-kanak. Hati wanita mudah tersentuh dengan lelaki yang sukakan kanak-kanak. Apabila si dia membelai kanak-kanak yang di temuinya.kamu memberikan perhatian kepadanya. Selepas itu kamu pula boleh mendukung sambil mengagah kanak-kanak itu. perbuatan kamu ini secara tidak langsung akan memperlihatkan yang kamu memang layak menjadi bapa yang penyayang.

8. Bijak Berdandan
Lelaki juga kena pandai merawat atau memanjakan tubuh. bagi yang mempunyai kulit berminyak, kamu perlu meluangkan masa untuk melakukan perawatan bagi mengelakkan jerawat atau penyakit kulit yang lain muncul. Selain berpakaian kemas dan sesuai. Kebersihan tubuh juga hendaklah diberi tumpuan. Kuku hendaklah dipotong rapi dan bersih. pendek kata, kebersihan tubuh mesti di jaga kerana ia memberikan kesan kepada hubungan kamu dan si dia nanti.

Apapun, tiada lelaki yang sempurna, namun kamu boleh berpura-pura menjadi sempurna. perlu di ingatkan, kamu semestinya mempunyai kelebihan yang tertentu. jadikan gunakan kelebihan itu dengan sebaik mungkin. yang penting kamu mampu melakukan sesuatu yang terbaik. Sementara yang selebihnya kamu bolehlah berpura-pura. Jika segalanya berjalan lancar dan hatinya sudah berjaya di tawan, tidak mustahil si dia akan menjadi permaisuri hidupmu.

Emm tu je,ini cuma pandangan saya,kalau ada yang kurang setuju,minta maaf,pendapat semua orang berbeza beza..betul kan?
Ngeee..senyum skit..
razz





-Sekian Terima Kasih-

Tips membezakan Handphone Original, AP, Underwater


Pernah TERbeli handphone underwater?AP?
Mesti sakit hati kan?
Rasa nak mengamuk je bila tahu handphone tu tidak HORIJIONAL kan?
Tapi bila pulangkan semula ke kedai tu,dorang buat2 tak layan..
Marah tidak?
Mestilah marah kan?rasa nak cekik je jurujual tu kan?padahal kita yoyo'O Sangat nak beli yang HORIJIONAL,sekali terbeli pulak yang celup..apa kesss!

Nah! saya bagi tips ni,mana tahu berguna buat kamu yang berhajat mahu beli handhone.

Kalau yang Original Set,
Jaminan 1 tahun untuk seluruhan telefon,cas bateri,
Kad jaminan ditulis kealamat nokia Central ( nokia Model ) dan Motorola Centra (Motorola Model)
Dikeluarkan oleh kilang milik jenama itu sendiri Nokia- ( kilang Nokia), Motorola (kilang Motorola)
nokia authorized salah satunya ( Zitron ), Sony Ericsson authorized salah satunya (T-choice )

kalau yang Ap Set,
Jaminan hanya 3-5 bulan, tidak termasuk monitor telefon
kad Jaminan ditulis kealamat selain dan nokia dan motorola ( centraL )
Dikeluarkan oleh pengilang yang mendapat lesen dari pengilang utama
selamat digunakan kerana mendapat pengesahan sirim

kalau Under Water
Tiada jaminan
biasanya tiada kad jaminan
dibawa masuk dari negara luar dan jual dengan harga murah, tiada pengesahan sirim dan menyalahi undang-undang kerana barang diseludup masuk ke negara ini.

Jadi sudah tahu sikit2 kan?bagus anak murid cekgu,cepat faham..emak selalu bagi makan kismis ke?o..baiknya emak awak..kimsalam kat emak ye..razzngeee..
SO,ingat2 tips ni kalau membeli handphone ok,jangan tersilap pulak,kalau AP set tu ok lagi,kalau underwater tu,nah menangis tidak ber air mata nanti..hehehe.

senyum sikitrazz



-Sekian Terima Kasih-

TIPS ATASI JERAWAT

Pagi2 ngadap cermin,
nampak jerawat terus kata"ish benci betul aku tengok jerawat gilak ni!!"
ish!!
picit dengan jari sambil kata"aduh sakit betul jerawat gilak ni!!
benci betul la!!
inilah diantara bait2 ngomelan adikku bila suda timbul jerawat.
pas tu saya kata dengan dia:

"pastikan wajah sentiasa dalam keadaan bersih"

"jangan terlalu kerap menggunakan mekap yang tebal di wajah"

"Bersihkan wajah dengan sempurna setiap kali selepas mengunakan mekap"

"Cuci wajah sekurang-kurangnya tiga kali sehari dengan air suam dan gunakan pembersih yang sesuai untuk kulit wajah yang berminyak dan berjerawat. lakukan dalam urutan berputar"

"Opss! awas, jangan lakukan urutan atau pembersihan yang berlebihan kerana ia akan menyebabkan iritasi"

"Elakkan daripada memicit jerawat dengan kuku! Memicit jerawat akan menyebabkan kulit menjadi bengkak, merah dan berparut.bab ni yg ko selalu buat kan?"

"Jagalah kebersihan rambut dan tangan kamu. jangan menyentuh wajah dalam kedaan jari yang kotor. Sebaiknya bersihkan tangan sebelum menyentuh wajah"

"hentiikan menggunakan mekap ketika wajah masih berjerawat"

"Sering berganti tuala pengelap wajah pastikan tuala tersebut lembut dan bersih"

"Lindung kulit dari sinar matahari kerana ia akan meransang kulit mengeluarkan lebih banyak sebum sehingga menyebabkan pertumbuhan jerawat"

"Jika jerawat tumbuh di bahagian belakang, pakailah pakaian yang longgar, ringan dan dapat menyerap peluh"

"kurangkan memakai skarf dan topi kerana ia sering menjadi tempat terkumpulnya minyak dan debu"

"Dapatkan nasihat doktor sekiranya jerawat tidak berkurangan"

"Kurangkan makanan yang pedas, berminyak dan berkalori"

pas tu adik jawab"ya kakaku sayang,itu jak aku dengar selalu tiada cara lain ka?emm"
pusing balik ngadap cermin.

saya jawab"kalau nak cara lain,bagi tinggal je muka tu kat singki tu,nanti kak tolong basuh selalu "amacam?setuju?

hak3..ganas tak saya?nge..nge..
kalau kamu setuju,kamu pun boleh amal tips saya beri tu..

NOTA RENDAH HATI;
Bukan tiada jerawat ,ada tu ada..tapi jarang ada sebab rajin konon saya amalkan tips2 diatas tu..
ngee..ngeee..
so kalau kamu mahu mengelakkan jerawat,cuba guna tips tu..insyaAllah berkesan...cuba kunun kamu try test..
senyum sikit...
aaaa..kan manis tu..


-Sekian Terima Kasih-

SEGMEN UP FOLLOWER DENGAN SEPANTAS KILAT

Assalammualaikum dan salam satu malaysia..

Nak join!! nak join!!nak join gak!!
"Segmen up follower dengan sepantas kilat "

Tengok komen dah 265org join tinggal 45org lagi nak capai 300..
cepat2!! nanti terlambat,kalau terlepas rugi nanti.

Ni kali kedua saya join segmen up follower,memang tak rugi selain follower bertambah,ilmu pun banyak di kongsi.terima kasih banyak2 kepada pihak penganjur.sayang kamu banyak2..ngeee..

Jadi,apa tunggu lagi..

Jom join segmen ni reramai !
yang pasti akan mengempak blog korang ! korang nak tahu kenapa ? sebab nama segmen ni pon 'segmen up follower dengan sepantas kilat' so follower korang pon akan bertambah sepantas kilat ..puas ? zass .

BELOM COBA BELOM TAW!
kan?kan?



macam mana nak join ?

arrowBuat entry bertajuk ''segmen up follower dengan sepantas kilat'' dan letak banner segmen

arrowLetak link ni http://blurrr4evablurr.blogspot.com/2011/12/segmen-up-follower-dengan-sepantas.html

arrow letak caption ' BELOM COBA, BELOM TAW ! '

arrowpostkan link entry anda di bahagian komen.


SIMPLE kan ?

SO..Apa tunggu lagi...jom pakat ramai2 JOIN SEGMEN NI.
sebelum komen mencapai 300.

Untuk keterangan lanjut sila klik SINI



-Sekian Terima Kasih-

TIPS PENJAGAAN KASUT KULIT


Siapa ada kasut kulit angkat tangan..ok bagus..
sekarang turun tangan..

Kasut kulit mahal kan?
Jadi..
Kalau da mahal semestinya kita kena jaga baik2 kan?
ok kali ni saya bagi kamu tips cara penjagaan kasut kulit terbaeek punya..
saya amalkan tips ni,alhamdulillah barangan kulit saya pun bertahan lama dan yang penting tetap cantik.

Baca tips ni

1. Jangan pakai kasut kulit setiap hari, Sekiranya hari ini anda memakainya, Keesokan harinya, ia perlu direhatkan dan gunakan kasut yang lain pula.Macam manusia juga,mesti mau rehat kan?setuju?

2.Kalau mahu bersihkan kasut kulit tu,bersihkan dengan berus lembut atau dengan kain yang bersih. untuk menyimpannya ia perlu di letakkan dengan pengeras kasut untuk mengekalkan bentuknya.

3. Masa terbaik membeli kasut adalah sebelah petang kerana kaki 'mengembang' lima hinga lapan peratus pada ketika itu.percaya tidak?try ukur petang ni,nanti da ukur gitau saya.boleh?hehe.

4. Elakkan kasut kulit terkena sinaran matahari yang keterlaluan kerana ia boleh merosakkan warna.

5. Sekiranya kasut kulit basah, keringkan ia dengan menekap kertas untuk mengeluarkan airnya, selepas itu biarkan ia kering sendiri.

Haaa..
tu je simple kan?
Rajin2 la jaga kebersihan kasut dan kaki kamu ye..
kalau kasut berbau kaki kamu pun automatik akan berbau..betul tidak??

NOTA TAKDE INSURANS

Dah tahu Kasut kulit memerlukan penjagaan yang lebih rumit berbanding kasut biasa.yang p beli kasut kulit tu kenapa?try beli kasut plastik pulak..mesti simple nak jaga..hehehe..jangan marah ya..wa cak..


-Sekian Terima Kasih-

TIPS GILA EXPRES:TIPS BUAT RAMBUT KEKUNINGAN ALA2 MAT SALLEH.

Wah. . Tajuk nampak best je,
Memang best pun,tips ni amat mudah untuk dilakukan,buat sendiri pun boleh,tak perlu bantuan sapa2 mana tau sebelum ni pernah bertekak dgn adik beradik sebab tak nak tolong warnakan rambut kan?

Dan apa yang best tips ni,bahan2 tak perlu mengeluarkan kos yang banyak,kalau duduk kampung lagilah free. .
Apa yang diutamakan kaHALALan nya.tiada yang halal melainkan yang HALAL.hihi

Jom cuba try test tips ni,

ok,apa yang perlu kamu lakukan:

lolpegi dapur,isikan air sebanyak 200ml kedlm mangkuk (jangan terlalu panas ok,main agak2 la)

lolambik segengam ibu kunyit serbuk pun boleh,bancuh dengan 200ml air suam tadi.jangan terlalu cair,lagi likat lagi baik.

lolambik cermin.

lolramas bancuhan kunyit tadi dan tenyeh2 kat rambut anda.lagi banyak lagi baik.

lolbiarkan seketika.

lolbilas bersih2,tengok cermin confirm rambut kuning dengan kulit2 kepala sekali. .Hak3. .

lolAkhir sekali,pegi jumpa ibu anda konfirm juga anda kena marah,kalau ibu penyayang paling pun geleng kepala.hihihihi

Amacam mudah dan simple kan?hak3. .
Nak cuba?
Dipersilakan,tapi lagi baik jangan cuba2.

La~la~la~la.

P/s: JAngan tiru aksi ini,budak2 perlulah bimbingan dan nasihat orang dewasa.

Nota Bersalah:
Huhuhu. .ampunkan mak kassim. .
kerana pembaziran waktu yang berlaku semata2 nak membaca tips tiada kesudahan ini. .
Ianya sekadar percubaan untuk buat kamu tersenyum. .kalau senyum suda,syukur la nak. .
Kalau belum. . .silakan senyum sekarang. . .Huhuhu.mak bersalah kassim..




-Sekian Terima Kasih-

6 TIPS TAMPIL MENAWAN

Wahh...
Bukan main lagi kononnya nak bagi tips tampil menawan,
menawan kah saya?menawan tu takda la,tapi manis adaa...hak3.
La~la~la~la~

Saya menawan ke tak menawan tu belakang kira,yang penting tips ni buat saya berjaya tawan hati suami saya..hak3.betul ka tu papa?hak3..(ish.sukanya dia)..nge3..
So kalau anda pun nak menawan hati si dia macam saya cuba tips ni,manatau betul2 menawankan lagi penampilan anda yang sudah menawan tu kan?kan?

NAH BACA TIPS NI,
razz
. Jangan keterlaluan
Maksudnya disini,anda tidak perlu mengenakan solekan yang keterlaluan untuk kelihatan cantik kerana akan mencacatkan penampilan anda. Oleh itu, elakkan memakai penggaris mata yang terlalu gelap dan tebal kerana anda akan kelihatan keterlaluan dan merosakkan solekan anda. Selain itu, memakai maskara juga perlu bersesuaian dengan mata. Memakai terlalu banyak maskara menyebabkan bulu mata anda kelihatan seperti palsu.Melainkan ianya benar2 palsu..nge..

Begitu juga dengan bedak asas,perlu sesuai dengan warna kulit muka. Jika tidak, wajah akan kelihatan terlalu gelap atau terlalu cerah daripada warna sebenar kulit anda. Jangan keterlaluan ketika mengenakan solekan agar wajah anda akan kelihatan cantik semulajadi.tapi takmo tiru si badut comel ok?hihi..

razz
. Mengenakan gincu dengan betul
Mengenakan gincu perlu disesuaikan dengan bentuk bibir dan warna kulit. Agar sapuan gincu kelihatan cantik, terlebih dahulu gariskan bibir anda dengan penggaris bibir agar ia terbentuk dengan sempurna dan pastikan garisan bibir tersebut tidak kelihatan. Jangan mengenakan garisan di luar bibir jika mahu bibir anda kelihatan tebal kerana ia akan nampak tidak semula jadi.pas tu,jangan pulak kalau yg berkulit cerah tu guna gincu colour putih,yg berkulit gelap lak gincu colour hitam..tu anayah diri sendiri tu..hihi.

razz
. Sesuaikan solekan dengan majlis yang dihadiri
Menghadiri sesuatu majlis atau sebarang aktiviti memerlukan anda mengenakan solekan yang berbeza. Oleh itu, anda perlu bijak dalam mengenakan solekan agar anda tidak akan kelihatan pelik ketika menghadiri majlis atau aktiviti tersebut.

Amat tidak bersesuaian untuk anda jika mengenakan solekan yang tebal untuk melakukan aktiviti riadah di tepi pantai. Selain itu, anda perlu bijak membezakan antara solekan siang dan solekan malam.jangan tetukar ye,jangan pakai bedak sejuk gi shopping lak..tu kes berat da tu..hihihi.

razz
. Jangan ragu-ragu mengenakan solekan
Ada wanita yang masih ragu-ragu untuk mengenakan sebarang solekan kerana khuatir akan kelihatan pelik atau keterlaluan. Usah bimbang kerana anda hanya mulakan dengan solekan yang nipis dan gunakan warna yang lembut. Mengenakan solekan yang nipis lebih baik daripada tidak mengenakan sebarang solekan langsung.

razz
Mengenal pasti keseluruhan penampilan anda
Penting untuk anda mengenal pasti apa yang bersesuaian dengan warna kulit, rambut dan juga bentuk muka dan badan. Pilih solekan yang sesuai dengan warna kulit agar ia kelihatan semula jadi. Contohnya, jika berkulit gelap, anda perlu mengenakan solekan dengan warna yang gelap. Selain itu, kenal pasti jenis kulit anda sama ada berminyak atau kering. Kulit yang berminyak memerlukan anda memakai pelembab yang mengawal minyak.

razz
Sentuhan terakhir
Setelah mengenakan solekan dengan sempurna, pastikan anda sentiasa touch up agar solekan anda tidak hilang atau pudar.

ok itu sahaja tipsnya,
Selamat mencuba..
Semoga yang tersayang akan tertawan..

senyum skitrazz

MUTIARA KATA
Bersederhanalah dalam menata rias diri,rambut haram diwarnakan..bermekap berlebihan juga blh bawa kepada tabarruj..cukuplah sederhana dan menepati syariat islam..ssudah cukup sejuk mata yg memandang..
senyum skit
razz






-Sekian Terima Kasih-

COPYRIGHT,DOODLE, AND TEMPLATE DESIGN ALL RIGHT RESERVED BY ARINA SHAMSUL wink